PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G06210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 479aa    MW: 50403.3 Da    PI: 7.0134
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G06210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP73.92.8e-23196244149
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                      +Cq+egC+adls ak+yhrrhkvC++h+ka++vl++g++qrfCqqCsr 
  ONIVA02G06210.1 196 RCQAEGCKADLSAAKHYHRRHKVCDFHAKAAAVLAAGKQQRFCQQCSRL 244
                      6***********************************************7 PP

2SBP477e-152652954777
                      SSEEETTT--SS--S-STTTT-------S-- CS
              SBP  47 srfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +rfh l efDe+krsCr+rL +hn+rrrk++
  ONIVA02G06210.1 265 ARFHVLAEFDEAKRSCRKRLTEHNRRRRKPT 295
                      7****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.3E-31190281IPR004333Transcription factor, SBP-box
PROSITE profilePS5114126.384194294IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.19E-22195248IPR004333Transcription factor, SBP-box
PfamPF031104.5E-18197247IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-11265296IPR004333Transcription factor, SBP-box
PfamPF031106.4E-8265293IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MAVPAAAVAA DIVDFGYAAP MPPPYVGFDP AGMGGERQLF QHGGACHGLY DGGLDFSAAA  60
AFQEAATLGV GLPGGNLLQS LAPPAAAAAT PSSLQMPMMM SLPGLPATAA DVYPFGGGGF  120
VKREDGPVLD VVGGGGGGRI GLNLGRRTYF SPADVLAVDR LLLRSRLGGM GMEMGMGMGV  180
LGLGLAAAAH HHQPPRCQAE GCKADLSAAK HYHRRHKVCD FHAKAAAVLA AGKQQRFCQQ  240
CSRLAPIPRN HVAARWDPAG TRVAARFHVL AEFDEAKRSC RKRLTEHNRR RRKPTAGGQS  300
SKDSPPPPPS KKGTDASIAS SYTSCDHHKA AASTTTASGV SCLQELADHH DVGGGHQAAM  360
AAPPPPTLSL AALPPQEEED EDEDGGLGTV LMMQQHHQRR RLQHDGDGDD DVAAAAAHHH  420
LMRSLARQQQ QHRHSSGCSN NNDGDDDDHN NNILSCSSAS DQQNSSNNNN MHFFEVDFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-231972931184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276293KRSCRKRLTEHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0048380.0AP004838.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0504A05.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624330.11e-159PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ0E3F80.0SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLA0A0E0G2750.0A0A0E0G275_ORYNI; Uncharacterized protein
STRINGORGLA02G0053800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-28squamosa promoter binding protein-like 8